PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 867626
Common NameARALYDRAFT_667070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 82aa    MW: 9790.27 Da    PI: 7.3572
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
867626genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.7e-083372445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +++eE++l+ +  k+ G + W +Ia +++ gRt++ +  +w+
           867626 33 MSEEEEDLIFRMYKLVGDR-WPLIAGRIP-GRTPEVIERYWL 72
                     79***************99.*********.*****9999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.5E-62977IPR001005SANT/Myb domain
CDDcd001673.76E-63273No hitNo description
PfamPF002491.3E-73373IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-73472IPR009057Homeodomain-like
PROSITE profilePS500906.263471IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.9E-103472IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009913Biological Processepidermal cell differentiation
GO:0010063Biological Processpositive regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MPEMDTRRWN QRKTTYASCS QEVTSIEWKV VTMSEEEEDL IFRMYKLVGD RWPLIAGRIP  60
GRTPEVIERY WLMKHGFFFA N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002878399.18e-56predicted protein
SwissprotO220594e-39CPC_ARATH; Transcription factor CPC
TrEMBLD7LSD58e-56D7LSD5_ARALL; Predicted protein
STRINGAl_scaffold_0005_31052e-55(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.13e-40MYB_related family protein